Chlorophycean_mitochondrial_code

Chlorophycean mitochondrial code

Chlorophycean mitochondrial code

An alternative genetic code found in the mitochondrial genome of some green algae

The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.

Code

   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

More information DNA codons, RNA codons ...

Systematic range and comments

Chlorophyceae[1] and the chytridiomycete fungus Spizellomyces punctatus.[2]

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [3]

  1. [1]
    Y Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33. doi:10.1007/s002940050096. PMID 8662206. S2CID 7175211.
  2. [2]
    M. J. Laforest; I. Roewer; B. F. Lang (1 February 1997). "Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine". Nucleic Acids Research. 25 (3): 626–32. doi:10.1093/nar/25.3.626. PMC 146481. PMID 9016605.
  3. [3]
    Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 10 August 2016.
Share this article:

This article uses material from the Wikipedia article Chlorophycean_mitochondrial_code, and is written by contributors. Text is available under a CC BY-SA 4.0 International License; additional terms may apply. Images, videos and audio are available under their respective licenses.