Ciliate,_dasycladacean_and_hexamita_nuclear_code

Ciliate, dasycladacean and hexamita nuclear code

Ciliate, dasycladacean and hexamita nuclear code

Alternative genetic code

The ciliate, dasycladacean and Hexamita nuclear code (translation table 6) is a genetic code used by certain ciliate, dasycladacean and Hexamita species.

The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.

The code

   AAs = FFLLSSSSYYQQCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V).

Differences from the standard code

More information DNA codons, RNA codons ...

Systematic range

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [4]

  1. [1]
    Hoffman DC, Anderson RC, DuBois ML, Prescott DM (1995). "Macronuclear gene-sized molecules of hypotrichs". Nucleic Acids Research. 23 (8): 1279–83. doi:10.1093/nar/23.8.1279. PMC 306850. PMID 7753617.
  2. [2]
    Schneider SU, Leible MB, Yang XP (1989). "Strong homology between the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase of two species of Acetabularia and the occurrence of unusual codon usage". Molecular & General Genetics. 218 (3): 445–52. doi:10.1007/bf00332408. PMID 2573818. S2CID 31247623.
  3. [3]
    Schneider SU, de Groot EJ (1991). "Sequences of two rbcS cDNA clones of Batophora oerstedii: structural and evolutionary considerations". Current Genetics. 20 (1–2): 173–5. doi:10.1007/bf00312782. PMID 1934113. S2CID 13509708.
  4. [4]
    Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 29 January 2016.


Stub icon

This genetics article is a stub. You can help Wikipedia by expanding it.
Share this article:

This article uses material from the Wikipedia article Ciliate,_dasycladacean_and_hexamita_nuclear_code, and is written by contributors. Text is available under a CC BY-SA 4.0 International License; additional terms may apply. Images, videos and audio are available under their respective licenses.