Scenedesmus_obliquus_mitochondrial_code

<i>Scenedesmus obliquus</i> mitochondrial code

Scenedesmus obliquus mitochondrial code

An alternative genetic code found in the mitochondrial genome of some green algae

The Scenedesmus obliquus mitochondrial code (translation table 22) is a genetic code found in the mitochondria of Scenedesmus obliquus, a species of green algae.[1]

Code

   AAs = FFLLSS*SYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

More information DNA codons, RNA codons ...

Systematic range and comments

See also

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [2]

  1. [1]
    A. M. Nedelcu, R. W. Lee, G. Lemieux, M. W. Gray, G. Burger (June 2000). "The complete mitochondrial DNA sequence of Scenedesmus obliquus reflects an intermediate stage in the evolution of the green algal mitochondrial genome". Genome Research. 10 (6): 819–31. doi:10.1101/gr.10.6.819. PMC 310893. PMID 10854413.{{cite journal}}: CS1 maint: multiple names: authors list (link)
  2. [2]
    Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 11 August 2016.


Stub icon

This genetics article is a stub. You can help Wikipedia by expanding it.
Share this article:

This article uses material from the Wikipedia article Scenedesmus_obliquus_mitochondrial_code, and is written by contributors. Text is available under a CC BY-SA 4.0 International License; additional terms may apply. Images, videos and audio are available under their respective licenses.